(data stored in ACNUC7421 zone)

EMBL: AP009493.PE330

AP009493.PE330       Location/Qualifiers
FT   CDS             357166..359298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_330"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17159"
FT                   /db_xref="GOA:B1VQ58"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ58"
FT                   /protein_id="BAG17159.1"
FT                   /translation="MTDDERRQDAEASPLRRIDRKTNGEIRPTERLAMNRTGSFDWDLD
FT                   NRTLDIDEAGLMVFGVDPATFEARPGALLEHLEPAERARLDVTVDEAITGGSNSYSVHF
FT                   RVPLDDGSTQWTHVQARILRSKNGRAHRIVGVVRDATAEVTHSAFVLDLEKRRQRQTNI
FT                   VERTTSAMSRAVTVDDVTAALTGPGGLARLGADGLALGLVENSALNIVALSGESLEVLD
FT                   GLGSGDLDRDLPLADTIRSGRPRFITSLSALARRYPELEPHLGTLRFRAAAYLPLVAQA
FT                   RSLGGLALFYRERTVFNADERILCLGLAAIVAQSLQRAMLFDEEREFATQLQSAMLPPR
FT                   IQDVAGGEIAVRYHAAWSGRQVGGDWYDVITLPKNRYGLVVGDVQGHDTHAAAIMGQLR
FT                   IALRAYASEGHPPATVLARASRFLAELDTDRFATCAYAQVDLASGTVQVVRAGHLGPLI
FT                   RHLDGRVGSPQVRGGLPLGTSTDLQDEEYPETRLDLVPGETFVLYTDGLVEEPGADLDT
FT                   GIDALRNEVSSGPAGAEALADHLSERLWERWGSGDDVALLVLRRSPDVGSSHAPRLHQY
FT                   IHQADPEGLSDARAIVRQALGDWDMAEFADDAELVTGELLVNVLLHTEGGAVLTLEVLP
FT                   EPVRRIRLSVQDRSSAWPRRRTPGETSTSGRGLLLLDAVATRWGIEPRGEGKAVWCEIG
FT                   PAPPPATTPPRTVAER"
     MTDDERRQDA EASPLRRIDR KTNGEIRPTE RLAMNRTGSF DWDLDNRTLD IDEAGLMVFG        60
     VDPATFEARP GALLEHLEPA ERARLDVTVD EAITGGSNSY SVHFRVPLDD GSTQWTHVQA       120
     RILRSKNGRA HRIVGVVRDA TAEVTHSAFV LDLEKRRQRQ TNIVERTTSA MSRAVTVDDV       180
     TAALTGPGGL ARLGADGLAL GLVENSALNI VALSGESLEV LDGLGSGDLD RDLPLADTIR       240
     SGRPRFITSL SALARRYPEL EPHLGTLRFR AAAYLPLVAQ ARSLGGLALF YRERTVFNAD       300
     ERILCLGLAA IVAQSLQRAM LFDEEREFAT QLQSAMLPPR IQDVAGGEIA VRYHAAWSGR       360
     QVGGDWYDVI TLPKNRYGLV VGDVQGHDTH AAAIMGQLRI ALRAYASEGH PPATVLARAS       420
     RFLAELDTDR FATCAYAQVD LASGTVQVVR AGHLGPLIRH LDGRVGSPQV RGGLPLGTST       480
     DLQDEEYPET RLDLVPGETF VLYTDGLVEE PGADLDTGID ALRNEVSSGP AGAEALADHL       540
     SERLWERWGS GDDVALLVLR RSPDVGSSHA PRLHQYIHQA DPEGLSDARA IVRQALGDWD       600
     MAEFADDAEL VTGELLVNVL LHTEGGAVLT LEVLPEPVRR IRLSVQDRSS AWPRRRTPGE       660
     TSTSGRGLLL LDAVATRWGI EPRGEGKAVW CEIGPAPPPA TTPPRTVAER                  710
//

If you have problems or comments...

PBIL Back to PBIL home page