(data stored in ACNUC7421 zone)

EMBL: AP009493.PE331

AP009493.PE331       Location/Qualifiers
FT   CDS             complement(359361..359960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_331"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17160"
FT                   /db_xref="GOA:B1VQ59"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ59"
FT                   /protein_id="BAG17160.1"
FT                   /translation="MAAAVVGLTGGVISAGPAAAHTPTWAVTCSEVTVDLTNYTSDVPN
FT                   TVTITVDGQDLLPTETFGREFHKKLTLPEHDEPVTVRLVVKDADGDGKHSVDDEKTADV
FT                   CDEEPSPTPTPTESVPGEPTPSETPSTGTPEPSATPSGQPSESAPAVPAPSPSSPDLAE
FT                   TGSSSSTPIIGGAAVAVLLAGGGILWAVRKRRTAQN"
     MAAAVVGLTG GVISAGPAAA HTPTWAVTCS EVTVDLTNYT SDVPNTVTIT VDGQDLLPTE        60
     TFGREFHKKL TLPEHDEPVT VRLVVKDADG DGKHSVDDEK TADVCDEEPS PTPTPTESVP       120
     GEPTPSETPS TGTPEPSATP SGQPSESAPA VPAPSPSSPD LAETGSSSST PIIGGAAVAV       180
     LLAGGGILWA VRKRRTAQN                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page