(data stored in ACNUC7421 zone)

EMBL: AP009493.PE334

AP009493.PE334       Location/Qualifiers
FT   CDS             complement(361537..362667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_334"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_334"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17163"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ62"
FT                   /protein_id="BAG17163.1"
FT                   /translation="MTVKQALRAHTVAQDADTKVRAVRARTRGARVNGTSVRGDARTGD
FT                   VGTEPEGEGVRTASAAPAVTVAAGRAAQELGIRRAEFELAVHLGQIAVVGVPGGGRPRV
FT                   HEEEIARLREQPGFPDGLAERVRTVGTAEGAALLDIAPARFTRLARAGCVSPVTFYLNR
FT                   YRAVVWLYLADELAAFAAREPDLLAGRTPPGMRSTLESGADWRPRNWRSQRIDRLLNRT
FT                   RDPWVRAAVQASALDPVQLAEVVDDPYERAYLVRVRPEPVFGRPGSLAAREAMGQLMLA
FT                   DDPDEILWRRVNLTLELDGARADRPAPRPGEDGATRAATAVRSGADTRGGTGLVPFAAE
FT                   PAPPPADAGLSTSAAKAAPTGKGLLARLGRRGRGTG"
     MTVKQALRAH TVAQDADTKV RAVRARTRGA RVNGTSVRGD ARTGDVGTEP EGEGVRTASA        60
     APAVTVAAGR AAQELGIRRA EFELAVHLGQ IAVVGVPGGG RPRVHEEEIA RLREQPGFPD       120
     GLAERVRTVG TAEGAALLDI APARFTRLAR AGCVSPVTFY LNRYRAVVWL YLADELAAFA       180
     AREPDLLAGR TPPGMRSTLE SGADWRPRNW RSQRIDRLLN RTRDPWVRAA VQASALDPVQ       240
     LAEVVDDPYE RAYLVRVRPE PVFGRPGSLA AREAMGQLML ADDPDEILWR RVNLTLELDG       300
     ARADRPAPRP GEDGATRAAT AVRSGADTRG GTGLVPFAAE PAPPPADAGL STSAAKAAPT       360
     GKGLLARLGR RGRGTG                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page