(data stored in ACNUC7421 zone)

EMBL: AP009493.PE335

AP009493.PE335       Location/Qualifiers
FT   CDS             complement(362777..363190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_335"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_335"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17164"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ63"
FT                   /protein_id="BAG17164.1"
FT                   /translation="MPLDRGLDWLLDDLTNRVQFIRHALVLSNDGLVTGASTGLAREDA
FT                   EHLAAVSSGLQSLARGSGRHFRAGRARQTMVEFDEALLFVTAAGDGSCLCVLTAAEADV
FT                   GQVAYEMTLLVNRVGEHLGVSVRQGGPDDTGPV"
     MPLDRGLDWL LDDLTNRVQF IRHALVLSND GLVTGASTGL AREDAEHLAA VSSGLQSLAR        60
     GSGRHFRAGR ARQTMVEFDE ALLFVTAAGD GSCLCVLTAA EADVGQVAYE MTLLVNRVGE       120
     HLGVSVRQGG PDDTGPV                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page