(data stored in ACNUC7421 zone)

EMBL: AP009493.PE337

AP009493.PE337       Location/Qualifiers
FT   CDS             complement(363787..364086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_337"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17166"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ65"
FT                   /protein_id="BAG17166.1"
FT                   /translation="MPGRALAAILPADTRRLGDCFTAVDHVERERIPYTAAVNRFPDAP
FT                   EHTPCDIARALDLNRSTPVLLCDPRAPASGKEVLIRTVEYAGRVHTAPLLASVG"
     MPGRALAAIL PADTRRLGDC FTAVDHVERE RIPYTAAVNR FPDAPEHTPC DIARALDLNR        60
     STPVLLCDPR APASGKEVLI RTVEYAGRVH TAPLLASVG                               99
//

If you have problems or comments...

PBIL Back to PBIL home page