(data stored in ACNUC7421 zone)

EMBL: AP009493.PE340

AP009493.PE340       Location/Qualifiers
FT   CDS             367844..368008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_340"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17169"
FT                   /db_xref="GOA:B1VQ68"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ68"
FT                   /protein_id="BAG17169.1"
FT                   /translation="MLRNGLAPWHLLILAVIVIAVFGSKKLPDTARALGKSMRILKSEA
FT                   RAMKDENAP"
     MLRNGLAPWH LLILAVIVIA VFGSKKLPDT ARALGKSMRI LKSEARAMKD ENAP              54
//

If you have problems or comments...

PBIL Back to PBIL home page