(data stored in ACNUC7421 zone)

EMBL: AP009493.PE341

AP009493.PE341       Location/Qualifiers
FT   CDS             368237..368812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_341"
FT                   /product="putative TerD-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_341"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17170"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ69"
FT                   /protein_id="BAG17170.1"
FT                   /translation="MGVTLAKGGNVSLSKEAPGLTAVTVGLGWDVRTTTGADHDLDASA
FT                   LLCSEAGKVLSDAHFVFYNNLNSPDGSVRHTGDNLTGEGEGDDESVEVDLASVPAEIAK
FT                   IVFPVSIHDAQSRGQSFGQVRNAFIRVVNRANGVELARYDLSEDASTETAMVFGELYRH
FT                   GAEWKFRAVGQGYASGLAGIASDYGVNV"
     MGVTLAKGGN VSLSKEAPGL TAVTVGLGWD VRTTTGADHD LDASALLCSE AGKVLSDAHF        60
     VFYNNLNSPD GSVRHTGDNL TGEGEGDDES VEVDLASVPA EIAKIVFPVS IHDAQSRGQS       120
     FGQVRNAFIR VVNRANGVEL ARYDLSEDAS TETAMVFGEL YRHGAEWKFR AVGQGYASGL       180
     AGIASDYGVN V                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page