(data stored in ACNUC7421 zone)

EMBL: AP009493.PE344

AP009493.PE344       Location/Qualifiers
FT   CDS             370666..371565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_344"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_344"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17173"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ72"
FT                   /protein_id="BAG17173.1"
FT                   /translation="MRRRAMSDEENTVAGVDSDVADDALLVLTAMMLTPARFPSVLGDD
FT                   YVAACGALALEPYEEGYGLVLGQDGDGARWTVVVEDASQVAVAIAAWDCGMEHDLSPDE
FT                   RSMVCALPGWPMDLAVSAPGVPDPHDPAVDGDGPAPLAPPDAEAWGPAQRRLGADEIAA
FT                   QWSMWREQLDGVEGSRPGAEGEPGSGAGGEQSGDAGSERDGEPFSAPRHPGVRRALSEA
FT                   TAYTKEPPPAGRIRSSYASADARTLRVDGPGWSMVARTDDIALFLLDEEPGTVIPVRRG
FT                   AALPGLLAALDGLAARPA"
     MRRRAMSDEE NTVAGVDSDV ADDALLVLTA MMLTPARFPS VLGDDYVAAC GALALEPYEE        60
     GYGLVLGQDG DGARWTVVVE DASQVAVAIA AWDCGMEHDL SPDERSMVCA LPGWPMDLAV       120
     SAPGVPDPHD PAVDGDGPAP LAPPDAEAWG PAQRRLGADE IAAQWSMWRE QLDGVEGSRP       180
     GAEGEPGSGA GGEQSGDAGS ERDGEPFSAP RHPGVRRALS EATAYTKEPP PAGRIRSSYA       240
     SADARTLRVD GPGWSMVART DDIALFLLDE EPGTVIPVRR GAALPGLLAA LDGLAARPA        299
//

If you have problems or comments...

PBIL Back to PBIL home page