(data stored in ACNUC7421 zone)

EMBL: AP009493.PE345

AP009493.PE345       Location/Qualifiers
FT   CDS             complement(371596..371784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_345"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17174"
FT                   /db_xref="GOA:B1VQ73"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ73"
FT                   /protein_id="BAG17174.1"
FT                   /translation="MTMSNGAKVAVGGVLAAAVLWPLIGFWWALLVVIGVPVAGYLLLD
FT                   PSQRRRLRRINRKQIGR"
     MTMSNGAKVA VGGVLAAAVL WPLIGFWWAL LVVIGVPVAG YLLLDPSQRR RLRRINRKQI        60
     GR                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page