(data stored in ACNUC7421 zone)

EMBL: AP009493.PE348

AP009493.PE348       Location/Qualifiers
FT   CDS             376204..377610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_348"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_348"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17177"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ76"
FT                   /protein_id="BAG17177.1"
FT                   /translation="MSDGYEDDDHAYGTGYGADGPDSFDGGDDEASRGGGRGTERVFAA
FT                   FPPAQGRGFATSWWGRAWLKALEDTALDGQQLKQGRRLAREGRVGAVSVRPGRITAVVR
FT                   DRDGSAYRSDVLLQQLGTGAWDRFLDMAVDRAGHIAALLDREMPPHLVEDAAGAGVELL
FT                   PGIGDLEPECTCGAWDHCPHSGALCYQVARLLDEDPFVLLLMRGREERRLLDELQVRSA
FT                   ARAVRAGGDGAREAADDAERNVHGVPAAEAFAAAGILPPLPAPPPVPVEPGLGPALDTE
FT                   TAPAPGVDPAALEVLAADSAVRAHRMLLDALAPGHEGQPVPVELTPRQDAVRLAADTRP
FT                   EPRIGARLAARSGRPAADLDAAVRAWRYGGVAALAVLDEEWTPDPEDLARGRARLGEAW
FT                   EAGERPALRANGRARWTVAGADLQLRLDRNGRWWPYRKERGRWVPAGPADDDPAGALAG
FT                   ADGAAADAAV"
     MSDGYEDDDH AYGTGYGADG PDSFDGGDDE ASRGGGRGTE RVFAAFPPAQ GRGFATSWWG        60
     RAWLKALEDT ALDGQQLKQG RRLAREGRVG AVSVRPGRIT AVVRDRDGSA YRSDVLLQQL       120
     GTGAWDRFLD MAVDRAGHIA ALLDREMPPH LVEDAAGAGV ELLPGIGDLE PECTCGAWDH       180
     CPHSGALCYQ VARLLDEDPF VLLLMRGREE RRLLDELQVR SAARAVRAGG DGAREAADDA       240
     ERNVHGVPAA EAFAAAGILP PLPAPPPVPV EPGLGPALDT ETAPAPGVDP AALEVLAADS       300
     AVRAHRMLLD ALAPGHEGQP VPVELTPRQD AVRLAADTRP EPRIGARLAA RSGRPAADLD       360
     AAVRAWRYGG VAALAVLDEE WTPDPEDLAR GRARLGEAWE AGERPALRAN GRARWTVAGA       420
     DLQLRLDRNG RWWPYRKERG RWVPAGPADD DPAGALAGAD GAAADAAV                    468
//

If you have problems or comments...

PBIL Back to PBIL home page