(data stored in ACNUC7421 zone)

EMBL: AP009493.PE352

AP009493.PE352       Location/Qualifiers
FT   CDS             complement(381837..382496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_352"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17181"
FT                   /db_xref="InterPro:IPR025326"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ80"
FT                   /protein_id="BAG17181.1"
FT                   /translation="MRMNRLAVTAVAVVAGLSLSACGGDDDATDTAAPSSPSATSAGTP
FT                   TQSSSPEEGDSAGTAPEEGAADQGSTGQESGGTGKIERCHTDDLTIKASDATIGDDPTK
FT                   AVAVELRNTSNRSCSIKGFAGVNLLSSEGAIPATRRDQKDDGTTLKAGEPTFFGIFYKG
FT                   NDSGGSGVKIKGLVVTPPDERKSVTLKWPGEPSLPITDSPETTVEIGPMGSIGQGG"
     MRMNRLAVTA VAVVAGLSLS ACGGDDDATD TAAPSSPSAT SAGTPTQSSS PEEGDSAGTA        60
     PEEGAADQGS TGQESGGTGK IERCHTDDLT IKASDATIGD DPTKAVAVEL RNTSNRSCSI       120
     KGFAGVNLLS SEGAIPATRR DQKDDGTTLK AGEPTFFGIF YKGNDSGGSG VKIKGLVVTP       180
     PDERKSVTLK WPGEPSLPIT DSPETTVEIG PMGSIGQGG                              219
//

If you have problems or comments...

PBIL Back to PBIL home page