(data stored in ACNUC7421 zone)

EMBL: AP009493.PE356

AP009493.PE356       Location/Qualifiers
FT   CDS             386408..388015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_356"
FT                   /product="putative phytoene dehydrogenase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_356"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17185"
FT                   /db_xref="GOA:B1VQ84"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ84"
FT                   /protein_id="BAG17185.1"
FT                   /translation="MNRFDVVVVGGGHNGLVTAAYLGRAGLRVAVIESRQRLGGPCGGY
FT                   AFLPGRSLAFTNSPGSLNPAVVHELRLADHGLRFVRADPTVVQQFDGRCFLGWRDPARV
FT                   DRQLDAFAPGEADRYRELISALERLGASLRVSLDEPPPGLAELRERLTDPEEHKLFSAV
FT                   FEGSLTGLLETRLVSDQAKALLALLALNAQLVPPSTPGSAVGLMMRPFALAAAGAPRSG
FT                   DAAERVALRGSTGLPVGSMSAIVDALEDCCRTHDVTLRTGSPVVRILHGPAGVRGVVTA
FT                   TGEEFTADRVVSAVNPVHLFRDLLDDAAMGPGIRAEVAGTAMRGSAFKVVLEVDSLPAY
FT                   AGLPADADPERVRACQFRVGSSLGGIEESISRALLGHASDQPLMWGLIPTLTSPGLTPG
FT                   KTHLISVNAWHAPYRPHDGPWDAERTDRFGRRCVEELSRLMPGLADRVVDHRFMNPVEI
FT                   ESELGLMESNITHGDMLPGNLFGARPHPEVAGYRTPLPGFYVSGAGTWPGGYVTGTPGR
FT                   NTAKAVLQDLHHEQRRQA"
     MNRFDVVVVG GGHNGLVTAA YLGRAGLRVA VIESRQRLGG PCGGYAFLPG RSLAFTNSPG        60
     SLNPAVVHEL RLADHGLRFV RADPTVVQQF DGRCFLGWRD PARVDRQLDA FAPGEADRYR       120
     ELISALERLG ASLRVSLDEP PPGLAELRER LTDPEEHKLF SAVFEGSLTG LLETRLVSDQ       180
     AKALLALLAL NAQLVPPSTP GSAVGLMMRP FALAAAGAPR SGDAAERVAL RGSTGLPVGS       240
     MSAIVDALED CCRTHDVTLR TGSPVVRILH GPAGVRGVVT ATGEEFTADR VVSAVNPVHL       300
     FRDLLDDAAM GPGIRAEVAG TAMRGSAFKV VLEVDSLPAY AGLPADADPE RVRACQFRVG       360
     SSLGGIEESI SRALLGHASD QPLMWGLIPT LTSPGLTPGK THLISVNAWH APYRPHDGPW       420
     DAERTDRFGR RCVEELSRLM PGLADRVVDH RFMNPVEIES ELGLMESNIT HGDMLPGNLF       480
     GARPHPEVAG YRTPLPGFYV SGAGTWPGGY VTGTPGRNTA KAVLQDLHHE QRRQA            535
//

If you have problems or comments...

PBIL Back to PBIL home page