(data stored in ACNUC7421 zone)

EMBL: AP009493.PE357

AP009493.PE357       Location/Qualifiers
FT   CDS             388012..389646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_357"
FT                   /product="putative ABC transporter periplasmic
FT                   dipeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_357"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17186"
FT                   /db_xref="GOA:B1VQ85"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ85"
FT                   /protein_id="BAG17186.1"
FT                   /translation="MRLSRRAGPQGPRTGILRRTLGCVTVAGLLITGCSANPSFGRDER
FT                   TLIIGAEGEIPTLDPHRASGTPVLRVIDALFDPLIREDLGTETAQAPELRPALAESWQA
FT                   SPDARTYTLKLREGVEFADGSPFDAAAVKANFDRIMDESSAFHDPTAAGNMKFLTRWIK
FT                   EVDVRDPRTVVLGLTEPYAGLPRVLTDRRMSIISPAALRTHRPDDIGLHPVGTGPFTQQ
FT                   SADRGKRITLKRNTAYWGGSPKTPSIIVESVTDPTTLAIAAQTGEVDAILSAGAQQVQQ
FT                   LADGGTMTAQYPEPANQYFIRLNTKIAPTDDAVFRRALNHAVDRRAIATLTGRQVAPST
FT                   GPLPRGNEAYREGSEAAAYSYDPEEARRLIRESGVSTPVTLRMLAPDSGPGFSQATEIM
FT                   SLIQQDLKAVGVRLDTQYMEFASLVAEEGNGYNDTTHGSFNGWTTGADAADFLERMFSG
FT                   ELHPPDGVNRGWYRNRDVDGLFDRARGEPDPDRRTALYREAAESIAADAPWVFLYQDRL
FT                   PRLLSRKVEGVVPAASVYIDYTTIRRR"
     MRLSRRAGPQ GPRTGILRRT LGCVTVAGLL ITGCSANPSF GRDERTLIIG AEGEIPTLDP        60
     HRASGTPVLR VIDALFDPLI REDLGTETAQ APELRPALAE SWQASPDART YTLKLREGVE       120
     FADGSPFDAA AVKANFDRIM DESSAFHDPT AAGNMKFLTR WIKEVDVRDP RTVVLGLTEP       180
     YAGLPRVLTD RRMSIISPAA LRTHRPDDIG LHPVGTGPFT QQSADRGKRI TLKRNTAYWG       240
     GSPKTPSIIV ESVTDPTTLA IAAQTGEVDA ILSAGAQQVQ QLADGGTMTA QYPEPANQYF       300
     IRLNTKIAPT DDAVFRRALN HAVDRRAIAT LTGRQVAPST GPLPRGNEAY REGSEAAAYS       360
     YDPEEARRLI RESGVSTPVT LRMLAPDSGP GFSQATEIMS LIQQDLKAVG VRLDTQYMEF       420
     ASLVAEEGNG YNDTTHGSFN GWTTGADAAD FLERMFSGEL HPPDGVNRGW YRNRDVDGLF       480
     DRARGEPDPD RRTALYREAA ESIAADAPWV FLYQDRLPRL LSRKVEGVVP AASVYIDYTT       540
     IRRR                                                                    544
//

If you have problems or comments...

PBIL Back to PBIL home page