(data stored in ACNUC7421 zone)

EMBL: AP009493.PE358

AP009493.PE358       Location/Qualifiers
FT   CDS             389660..390610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_358"
FT                   /product="putative peptide ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_358"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17187"
FT                   /db_xref="GOA:B1VQ86"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ86"
FT                   /protein_id="BAG17187.1"
FT                   /translation="MKATAAPPRPAGVRATPPRRRTRLRALLGSGNATALIGGSIVAVT
FT                   IIVAVLAPLIAPDDPLATNPSSIGLGPFSGGHLLGTDEVGRDILSRLMYGTRLALLVAV
FT                   VPTLVALVIGGCLGLLSGYVGGWLDSTLMRVFDVMFSFPGILLALGIGVALGPGITSMV
FT                   IAMVVVTVPEFGRIVRGNVIALRQEQYVEAAGALGYSHLRIALRHITPNLLGGVVVFAT
FT                   LQTGRNVILSSSLAFLGLGAQPPTPDWGQMLSGGRALLVTAPHVATIPGLAIVVLAVGF
FT                   NLLGDGIRDRLDPRSRRSRAVRGGGRTLRTRRSRS"
     MKATAAPPRP AGVRATPPRR RTRLRALLGS GNATALIGGS IVAVTIIVAV LAPLIAPDDP        60
     LATNPSSIGL GPFSGGHLLG TDEVGRDILS RLMYGTRLAL LVAVVPTLVA LVIGGCLGLL       120
     SGYVGGWLDS TLMRVFDVMF SFPGILLALG IGVALGPGIT SMVIAMVVVT VPEFGRIVRG       180
     NVIALRQEQY VEAAGALGYS HLRIALRHIT PNLLGGVVVF ATLQTGRNVI LSSSLAFLGL       240
     GAQPPTPDWG QMLSGGRALL VTAPHVATIP GLAIVVLAVG FNLLGDGIRD RLDPRSRRSR       300
     AVRGGGRTLR TRRSRS                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page