(data stored in ACNUC7421 zone)

EMBL: AP009493.PE359

AP009493.PE359       Location/Qualifiers
FT   CDS             390630..391577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_359"
FT                   /product="putative peptide ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_359"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17188"
FT                   /db_xref="GOA:B1VQ87"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ87"
FT                   /protein_id="BAG17188.1"
FT                   /translation="MLTFTLRRALHMLPVILGVTIATFGLGQIIPGDQASALLGPTASE
FT                   ADRQALREDLGLDEPAVSRYFTYLGSLFDGDLGRSLSFGRPVSEVLSDRLLNTLLLSGT
FT                   AIVLAAVVGVAIGTWAAQKPGSHRDRSLTVGVLFFNSVPSFWFGLVLIIVFSLQLRMLP
FT                   ATGMTSIGGGGALDVAAHMVLPVITLAAWSLAVIARMTRSSVLEVIGNDYVRTARSRGV
FT                   GEFRVIVRHVLPNAMPSVITVIGLQAGFLLSGAVLTETVFSWPGIGLALHQAISARDIP
FT                   LVQGGILVIAIAFVLINFLVDVLQAYFNPKIKLA"
     MLTFTLRRAL HMLPVILGVT IATFGLGQII PGDQASALLG PTASEADRQA LREDLGLDEP        60
     AVSRYFTYLG SLFDGDLGRS LSFGRPVSEV LSDRLLNTLL LSGTAIVLAA VVGVAIGTWA       120
     AQKPGSHRDR SLTVGVLFFN SVPSFWFGLV LIIVFSLQLR MLPATGMTSI GGGGALDVAA       180
     HMVLPVITLA AWSLAVIARM TRSSVLEVIG NDYVRTARSR GVGEFRVIVR HVLPNAMPSV       240
     ITVIGLQAGF LLSGAVLTET VFSWPGIGLA LHQAISARDI PLVQGGILVI AIAFVLINFL       300
     VDVLQAYFNP KIKLA                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page