(data stored in ACNUC7421 zone)

EMBL: AP009493.PE36

AP009493.PE36        Location/Qualifiers
FT   CDS             40151..40579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_36t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_36t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16865"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKM0"
FT                   /protein_id="BAG16865.1"
FT                   /translation="MSMRSSARFRSTITGAAVCSALALGSVLAGPGTAVASAETGQNST
FT                   SVSAASCNVIYRVSTNYKGWTANYSWAWNINVAQGDTGDRVREIQCLLIFKGFGVGAVD
FT                   GDFGPATRTAVVAFQKNRGLDYDGIVGANTWRKLRVRD"
     MSMRSSARFR STITGAAVCS ALALGSVLAG PGTAVASAET GQNSTSVSAA SCNVIYRVST        60
     NYKGWTANYS WAWNINVAQG DTGDRVREIQ CLLIFKGFGV GAVDGDFGPA TRTAVVAFQK       120
     NRGLDYDGIV GANTWRKLRV RD                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page