(data stored in ACNUC7421 zone)

EMBL: AP009493.PE360

AP009493.PE360       Location/Qualifiers
FT   CDS             391938..392615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_360"
FT                   /product="putative peptide ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_360"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17189"
FT                   /db_xref="GOA:B1VQ88"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ88"
FT                   /protein_id="BAG17189.1"
FT                   /translation="MAEPLIHYDGFSRRAAASRCAELLDLVGLPAARERLRSYPHELSG
FT                   GMRQRVLIAMAISREPQVLIADEPTTALDVTIQSQVLQLIDRLRKDLRMALILITHDLG
FT                   VVAGVTDRIAVMYAGRIVETAPTTAIFDHPGHPYTRALMESIPRMDRERVEHLPAIPGF
FT                   PPDPAAPPPGCAFQPRCSAARAACEDAVPVLLPLTSSAHGHLVRCPYPAPVPVGADHRG
FT                   EPS"
     MAEPLIHYDG FSRRAAASRC AELLDLVGLP AARERLRSYP HELSGGMRQR VLIAMAISRE        60
     PQVLIADEPT TALDVTIQSQ VLQLIDRLRK DLRMALILIT HDLGVVAGVT DRIAVMYAGR       120
     IVETAPTTAI FDHPGHPYTR ALMESIPRMD RERVEHLPAI PGFPPDPAAP PPGCAFQPRC       180
     SAARAACEDA VPVLLPLTSS AHGHLVRCPY PAPVPVGADH RGEPS                       225
//

If you have problems or comments...

PBIL Back to PBIL home page