(data stored in ACNUC7421 zone)

EMBL: AP009493.PE361

AP009493.PE361       Location/Qualifiers
FT   CDS             392612..393739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_361"
FT                   /product="putative peptide ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_361"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17190"
FT                   /db_xref="GOA:B1VQ89"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ89"
FT                   /protein_id="BAG17190.1"
FT                   /translation="MNTLGTSPPEPTGPAVPAVSVAGLRVHFPIRTGVLRRVTGTAHAV
FT                   DGVSFTVPARSIVTIVGESGSGKTTTGRALVGLSPITGGWVSVHGLPLDEIRRAGALPR
FT                   LAQIVYQDPYASLNPRMTIRAMIREVITVHRTTPREKTGERVEELLAQVGLRTELADRY
FT                   PHELSGGQRQRAAIARALAVEPRFIVCDEIVSALDVSIQGQIVNLLKDLRREQDVSFLF
FT                   ISHDMSVVRHISDHVIVMYGGLIMESGPCDEVFSAPRHPYTHALLAAVPVPDPRAPGLR
FT                   GGTHTRAEPPDPSGPLPGCRFQRSCAFATEVCREGAPPPAVAAGADGHTVACHHADSPG
FT                   LRAALSPKHPSTDDPKTPVAPHSTDGPATERTTAP"
     MNTLGTSPPE PTGPAVPAVS VAGLRVHFPI RTGVLRRVTG TAHAVDGVSF TVPARSIVTI        60
     VGESGSGKTT TGRALVGLSP ITGGWVSVHG LPLDEIRRAG ALPRLAQIVY QDPYASLNPR       120
     MTIRAMIREV ITVHRTTPRE KTGERVEELL AQVGLRTELA DRYPHELSGG QRQRAAIARA       180
     LAVEPRFIVC DEIVSALDVS IQGQIVNLLK DLRREQDVSF LFISHDMSVV RHISDHVIVM       240
     YGGLIMESGP CDEVFSAPRH PYTHALLAAV PVPDPRAPGL RGGTHTRAEP PDPSGPLPGC       300
     RFQRSCAFAT EVCREGAPPP AVAAGADGHT VACHHADSPG LRAALSPKHP STDDPKTPVA       360
     PHSTDGPATE RTTAP                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page