(data stored in ACNUC7421 zone)

EMBL: AP009493.PE365

AP009493.PE365       Location/Qualifiers
FT   CDS             396655..397233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_365"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_365"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17194"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ93"
FT                   /protein_id="BAG17194.1"
FT                   /translation="MTDLKAELHRKLLAGRAGLISRLEGLTEYDMRRPMTPTGANLLGL
FT                   VKHLAGLEYGYLGESFGRPAPEALAWVEDGSIWEGADMWARPEESSEYIIGLYQRACAH
FT                   ADRTLTDLALDTPGRVAHWPEDRRATTLGVLLVRMVSETAQHAGHADVLRELIDGKAGP
FT                   DHDDFGDDAQWRQYHARIQAAADTHRVLS"
     MTDLKAELHR KLLAGRAGLI SRLEGLTEYD MRRPMTPTGA NLLGLVKHLA GLEYGYLGES        60
     FGRPAPEALA WVEDGSIWEG ADMWARPEES SEYIIGLYQR ACAHADRTLT DLALDTPGRV       120
     AHWPEDRRAT TLGVLLVRMV SETAQHAGHA DVLRELIDGK AGPDHDDFGD DAQWRQYHAR       180
     IQAAADTHRV LS                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page