(data stored in ACNUC7421 zone)

EMBL: AP009493.PE376

AP009493.PE376       Location/Qualifiers
FT   CDS             412234..412695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_376"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17205"
FT                   /db_xref="InterPro:IPR025851"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQA4"
FT                   /protein_id="BAG17205.1"
FT                   /translation="MNDAEAASLLAGCARFPYPGAWQDSPFAGRTVGGARYAVVAVDPG
FT                   LSVLGLRRDDGSLWCLPEDGAPRLVNSSVEAFVAFNRAYEEAAAEAAAYEGPGDGLDED
FT                   EAVDLAEEAADALTEALLERFGMLDAEAVADENSFWHIGAEELGYGMSV"
     MNDAEAASLL AGCARFPYPG AWQDSPFAGR TVGGARYAVV AVDPGLSVLG LRRDDGSLWC        60
     LPEDGAPRLV NSSVEAFVAF NRAYEEAAAE AAAYEGPGDG LDEDEAVDLA EEAADALTEA       120
     LLERFGMLDA EAVADENSFW HIGAEELGYG MSV                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page