(data stored in ACNUC7421 zone)

EMBL: AP009493.PE377

AP009493.PE377       Location/Qualifiers
FT   CDS             412688..412849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_377"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17206"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQA5"
FT                   /protein_id="BAG17206.1"
FT                   /translation="MCDHAEHRGTRLLKPRDHEGASVPADAPFAADAGARPAQLTLRRH
FT                   PTSAWHHM"
     MCDHAEHRGT RLLKPRDHEG ASVPADAPFA ADAGARPAQL TLRRHPTSAW HHM               53
//

If you have problems or comments...

PBIL Back to PBIL home page