(data stored in ACNUC7421 zone)

EMBL: AP009493.PE379

AP009493.PE379       Location/Qualifiers
FT   CDS             414124..414531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_379"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17208"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQA7"
FT                   /protein_id="BAG17208.1"
FT                   /translation="MSVRKKTALALAAVTLTTGLATGAGAATAAPASASASASASGQRA
FT                   AVECGVRADGKLWCGNRVGAKGYEHRTYRSGVRGSLTSSFSWFVCWGPGDNHAGGNNIW
FT                   YWTLLDNGQWGNVPAVDVHTPSDPWGNLRQC"
     MSVRKKTALA LAAVTLTTGL ATGAGAATAA PASASASASA SGQRAAVECG VRADGKLWCG        60
     NRVGAKGYEH RTYRSGVRGS LTSSFSWFVC WGPGDNHAGG NNIWYWTLLD NGQWGNVPAV       120
     DVHTPSDPWG NLRQC                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page