(data stored in ACNUC7421 zone)

EMBL: AP009493.PE38

AP009493.PE38        Location/Qualifiers
FT   CDS             complement(41358..41519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_38t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_38t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16867"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLW6"
FT                   /protein_id="BAG16867.1"
FT                   /translation="MSGQDEGEALYLRSGKALEVVAGGTVDGAVVAQRAYEGSDADHQH
FT                   WSGSLSAR"
     MSGQDEGEAL YLRSGKALEV VAGGTVDGAV VAQRAYEGSD ADHQHWSGSL SAR               53
//

If you have problems or comments...

PBIL Back to PBIL home page