(data stored in ACNUC7421 zone)

EMBL: AP009493.PE382

AP009493.PE382       Location/Qualifiers
FT   CDS             complement(416939..417763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_382"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17211"
FT                   /db_xref="GOA:B1VQB0"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQB0"
FT                   /protein_id="BAG17211.1"
FT                   /translation="MVSIGVPLAIFLALPILVSEVSEEIARILPAPTSPVAVAAIVGSL
FT                   ALTAFLIAYFRPERTDRAEGESRQRLAQAEFALADALRGTHSFETGTPVPHARADEHGG
FT                   TAADEASYRRRLLGLPELWEATHARLDLYHRIATSQAETSFRNAQRAMVAGFLLLILFA
FT                   GIALWASTTAVAIVAGGLGAVSAALAGYVAKTFIRSQEAAATHLRSYFDQPLELSRYLA
FT                   AERLVADGDLSQEQRGEILSALVQAMATGPQPPPAAPQSVVVASVPGQQAAA"
     MVSIGVPLAI FLALPILVSE VSEEIARILP APTSPVAVAA IVGSLALTAF LIAYFRPERT        60
     DRAEGESRQR LAQAEFALAD ALRGTHSFET GTPVPHARAD EHGGTAADEA SYRRRLLGLP       120
     ELWEATHARL DLYHRIATSQ AETSFRNAQR AMVAGFLLLI LFAGIALWAS TTAVAIVAGG       180
     LGAVSAALAG YVAKTFIRSQ EAAATHLRSY FDQPLELSRY LAAERLVADG DLSQEQRGEI       240
     LSALVQAMAT GPQPPPAAPQ SVVVASVPGQ QAAA                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page