(data stored in ACNUC7421 zone)

EMBL: AP009493.PE384

AP009493.PE384       Location/Qualifiers
FT   CDS             complement(418079..418528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_384"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_384"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17213"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQB2"
FT                   /protein_id="BAG17213.1"
FT                   /translation="MSKIEESVEVAVPVRTVYDQWTQFEEFPKFMEGVQRIEQRTPTLT
FT                   HWVTKVDGVGREFDAEITEQIPDERVAWTTVAGEVRQAGVVTFHRLDDTHTKVMLQLDH
FT                   DPQGIADTVGDKLGFVRRQAKSDLKNFKEFIEARGNATGAWRGTN"
     MSKIEESVEV AVPVRTVYDQ WTQFEEFPKF MEGVQRIEQR TPTLTHWVTK VDGVGREFDA        60
     EITEQIPDER VAWTTVAGEV RQAGVVTFHR LDDTHTKVML QLDHDPQGIA DTVGDKLGFV       120
     RRQAKSDLKN FKEFIEARGN ATGAWRGTN                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page