(data stored in ACNUC7421 zone)

EMBL: AP009493.PE385

AP009493.PE385       Location/Qualifiers
FT   CDS             complement(418679..421909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_385"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17214"
FT                   /db_xref="GOA:B1VQB3"
FT                   /db_xref="InterPro:IPR003539"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQB3"
FT                   /protein_id="BAG17214.1"
FT                   /translation="MKIFGRIAAAVVAVSLLLLGVAAPTSAAPGEIQGKKFATWNLQGG
FT                   TDGTDSKWTTGVQRLVFGYGSEVSAHNVVALQEAGSRPPGTHRNIVASSVIAGQTYEVA
FT                   ETLWQVDGEHRYIYFMETDPTGHRVNLAMVTDRVPDAVYIVPGSSSIERSRPSFGVRFG
FT                   SNIFWTVHALSGGGNDAPAYIRNMNALAGVHYSWLAMGDFNQDPAALRERMPRGGTDFP
FT                   LAHVEDSGDNTYQGASELDYAVGSIDLAAGVTAHVLPNLAGSDHWPVEFRPLPELSDED
FT                   VAVRVMPVGDSITYGVGSLDVNGYREELYGGLAYMDLDPDFIGSNSSGSMGDPQHNGHR
FT                   GYKIDDITEIVKRDTGVMRPNVVTLMAGTNDVQSNADVAGAPARLGKMIDTLQAESPGV
FT                   AIAVATLVPIKNDPAAQTRRDAFNVEVRALVKDRQARGQRVELAEFGPMTDAMLFDRLH
FT                   PNDRGYAYMAEEFFQAVMTMRAKGWIEKAGSGGDGSGCPAPGGGWGELGRIAQGPAEAA
FT                   AKDVHGEVRLPDLNGDGRADYAVLTKSGEVYLWTRTTEGWSNRGRVADGTGAAADRVRF
FT                   ADMDGDGDDDYLVVDDEGVVTAWRNDGVADRGGAWKAMGVIADRSGNTVPQELGPGKYV
FT                   QFADIDGDGDDDYLVVHPHEVLGQKGVIWGWLNDGVFQHGRSAWKFVGWIGHHKSDSEG
FT                   PADVRLADMDGDGDADYLIVSESGAVNVRRNNLGSDPEKWLYEWGESSPIAKGTGIGGS
FT                   SVLLADADADGDADYFTRLPDGTVNWWENDEVATRPDWEHGFIRKGLYADHLKDPAAFA
FT                   RTVHFADMDADGDADYVVVGSKGEAWGWRNDDVAERGTNAWIRMGLIAEGVTPSTAERI
FT                   VFADYDGDGYDDYLVVNDRNGATRAWHNEGVFTKGVTAWTSRGTMAHGPAAAAHGEVRF
FT                   ADIDADGRDDYLVVAPDHSVQAWKNQGTNAGDGGGWATPVLLARPSTYGAGQQTMFANL
FT                   NCDGRADYVLRDPAANNLLYGWFNLGDFTNNWSPKKKVAHGVAMGFPVDIHLADLSGDG
FT                   ADDYLVVDPENGATRAWLNKGGNQADPG"
     MKIFGRIAAA VVAVSLLLLG VAAPTSAAPG EIQGKKFATW NLQGGTDGTD SKWTTGVQRL        60
     VFGYGSEVSA HNVVALQEAG SRPPGTHRNI VASSVIAGQT YEVAETLWQV DGEHRYIYFM       120
     ETDPTGHRVN LAMVTDRVPD AVYIVPGSSS IERSRPSFGV RFGSNIFWTV HALSGGGNDA       180
     PAYIRNMNAL AGVHYSWLAM GDFNQDPAAL RERMPRGGTD FPLAHVEDSG DNTYQGASEL       240
     DYAVGSIDLA AGVTAHVLPN LAGSDHWPVE FRPLPELSDE DVAVRVMPVG DSITYGVGSL       300
     DVNGYREELY GGLAYMDLDP DFIGSNSSGS MGDPQHNGHR GYKIDDITEI VKRDTGVMRP       360
     NVVTLMAGTN DVQSNADVAG APARLGKMID TLQAESPGVA IAVATLVPIK NDPAAQTRRD       420
     AFNVEVRALV KDRQARGQRV ELAEFGPMTD AMLFDRLHPN DRGYAYMAEE FFQAVMTMRA       480
     KGWIEKAGSG GDGSGCPAPG GGWGELGRIA QGPAEAAAKD VHGEVRLPDL NGDGRADYAV       540
     LTKSGEVYLW TRTTEGWSNR GRVADGTGAA ADRVRFADMD GDGDDDYLVV DDEGVVTAWR       600
     NDGVADRGGA WKAMGVIADR SGNTVPQELG PGKYVQFADI DGDGDDDYLV VHPHEVLGQK       660
     GVIWGWLNDG VFQHGRSAWK FVGWIGHHKS DSEGPADVRL ADMDGDGDAD YLIVSESGAV       720
     NVRRNNLGSD PEKWLYEWGE SSPIAKGTGI GGSSVLLADA DADGDADYFT RLPDGTVNWW       780
     ENDEVATRPD WEHGFIRKGL YADHLKDPAA FARTVHFADM DADGDADYVV VGSKGEAWGW       840
     RNDDVAERGT NAWIRMGLIA EGVTPSTAER IVFADYDGDG YDDYLVVNDR NGATRAWHNE       900
     GVFTKGVTAW TSRGTMAHGP AAAAHGEVRF ADIDADGRDD YLVVAPDHSV QAWKNQGTNA       960
     GDGGGWATPV LLARPSTYGA GQQTMFANLN CDGRADYVLR DPAANNLLYG WFNLGDFTNN      1020
     WSPKKKVAHG VAMGFPVDIH LADLSGDGAD DYLVVDPENG ATRAWLNKGG NQADPG          1076
//

If you have problems or comments...

PBIL Back to PBIL home page