(data stored in ACNUC7421 zone)

EMBL: AP009493.PE386

AP009493.PE386       Location/Qualifiers
FT   CDS             422407..422748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_386"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17215"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQB4"
FT                   /protein_id="BAG17215.1"
FT                   /translation="MLPPRLLWCDPRPIPRFNRQEPVTLILRDPGFHEPADEDGCTTFS
FT                   YFCRTHDRFYGRKTCGEGPHLVALHCKKHGPESMWPQPLTLLFPQGFEPSLSEAQLSWL
FT                   EAEWEAAGA"
     MLPPRLLWCD PRPIPRFNRQ EPVTLILRDP GFHEPADEDG CTTFSYFCRT HDRFYGRKTC        60
     GEGPHLVALH CKKHGPESMW PQPLTLLFPQ GFEPSLSEAQ LSWLEAEWEA AGA              113
//

If you have problems or comments...

PBIL Back to PBIL home page