(data stored in ACNUC7421 zone)

EMBL: AP009493.PE388

AP009493.PE388       Location/Qualifiers
FT   CDS             424480..425262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_388"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17217"
FT                   /db_xref="GOA:B1VQB6"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQB6"
FT                   /protein_id="BAG17217.1"
FT                   /translation="MPGFLSDLPTFWAFAAVWGGAVAMFMVFSLVRLRFVLRRDRQAIS
FT                   RFFEAGEAMPLLAMHHLEGERAATYAGMLVLASEPRPRATGRTEVEAHPLLASLRTAVD
FT                   DAGGSGTLAEVRASPRFPAFRSELRRAAARALPSHRTRDVPGAREGWAAVCGLIAVLAL
FT                   GVGFYGRQAGGSGLWFMIALAVHAPVAVWLFVADGRRGPDQWPEFTALCQRCVTEAGVR
FT                   SPEPERAAGNGSPAASGWAGDGGVGASSSCGGGCGGGT"
     MPGFLSDLPT FWAFAAVWGG AVAMFMVFSL VRLRFVLRRD RQAISRFFEA GEAMPLLAMH        60
     HLEGERAATY AGMLVLASEP RPRATGRTEV EAHPLLASLR TAVDDAGGSG TLAEVRASPR       120
     FPAFRSELRR AAARALPSHR TRDVPGAREG WAAVCGLIAV LALGVGFYGR QAGGSGLWFM       180
     IALAVHAPVA VWLFVADGRR GPDQWPEFTA LCQRCVTEAG VRSPEPERAA GNGSPAASGW       240
     AGDGGVGASS SCGGGCGGGT                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page