(data stored in ACNUC7421 zone)

EMBL: AP009493.PE39

AP009493.PE39        Location/Qualifiers
FT   CDS             complement(41588..42166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_39t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_39t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16868"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLW7"
FT                   /protein_id="BAG16868.1"
FT                   /translation="MGRPGALPAVYPPPLGLDLSSSAVISRFPGRWWGGSSPARDADDN
FT                   PVPARLPLPRRTLWHRARDPGDDARVINRELSSRLAAGRDRRVTQLAEAAARWGGHVPD
FT                   DPGITELADLLETAANAPDRSGNPDHPGGPGHTARALLAGAVENLRAAARLGGLLPAIT
FT                   LWHLQRAIDQEHTAHQQHTAPARRKAHDR"
     MGRPGALPAV YPPPLGLDLS SSAVISRFPG RWWGGSSPAR DADDNPVPAR LPLPRRTLWH        60
     RARDPGDDAR VINRELSSRL AAGRDRRVTQ LAEAAARWGG HVPDDPGITE LADLLETAAN       120
     APDRSGNPDH PGGPGHTARA LLAGAVENLR AAARLGGLLP AITLWHLQRA IDQEHTAHQQ       180
     HTAPARRKAH DR                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page