(data stored in ACNUC7421 zone)

EMBL: AP009493.PE390

AP009493.PE390       Location/Qualifiers
FT   CDS             426191..426529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_390"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17219"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQB8"
FT                   /protein_id="BAG17219.1"
FT                   /translation="MEAAVFGGELRRSRLPVENMGDDDLWIFVEPYGEDYWLKPGDVFT
FT                   VAPEVEGIDVWFSTAVCPEGITVWLYEDGDPTKVVLKYTVSDADGTRLECGHQRPPKPA
FT                   GWSTPEPG"
     MEAAVFGGEL RRSRLPVENM GDDDLWIFVE PYGEDYWLKP GDVFTVAPEV EGIDVWFSTA        60
     VCPEGITVWL YEDGDPTKVV LKYTVSDADG TRLECGHQRP PKPAGWSTPE PG               112
//

If you have problems or comments...

PBIL Back to PBIL home page