(data stored in ACNUC7421 zone)

EMBL: AP009493.PE391

AP009493.PE391       Location/Qualifiers
FT   CDS             426713..426907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_391"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17220"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQB9"
FT                   /protein_id="BAG17220.1"
FT                   /translation="MVPCRHHVPSPISTVSLRKPLRDRPLVYCGLAWSRAEEASACAAT
FT                   VAERMGLVCFDVQQDRLRP"
     MVPCRHHVPS PISTVSLRKP LRDRPLVYCG LAWSRAEEAS ACAATVAERM GLVCFDVQQD        60
     RLRP                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page