(data stored in ACNUC7421 zone)

EMBL: AP009493.PE393

AP009493.PE393       Location/Qualifiers
FT   CDS             complement(427537..427815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_393"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17222"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQC1"
FT                   /protein_id="BAG17222.1"
FT                   /translation="MTAARIPRQLDLQEDAARALADGLRAQIDDLQSRLRESETHLEHL
FT                   AITRRTVTGLADRLPAVVPDLHPSQAETPGQLGILTEVGTGSFARKP"
     MTAARIPRQL DLQEDAARAL ADGLRAQIDD LQSRLRESET HLEHLAITRR TVTGLADRLP        60
     AVVPDLHPSQ AETPGQLGIL TEVGTGSFAR KP                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page