(data stored in ACNUC7421 zone)

EMBL: AP009493.PE395

AP009493.PE395       Location/Qualifiers
FT   CDS             428425..428703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_395"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17224"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQC3"
FT                   /protein_id="BAG17224.1"
FT                   /translation="MGEAELSVRGQKERLSSSGRNHSETSAAGTSRPPPAREEGHGFMS
FT                   AAVRATLDPTVVDPGVQGLVPAPMLGSERQLHEGMEKETPRRPTSSF"
     MGEAELSVRG QKERLSSSGR NHSETSAAGT SRPPPAREEG HGFMSAAVRA TLDPTVVDPG        60
     VQGLVPAPML GSERQLHEGM EKETPRRPTS SF                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page