(data stored in ACNUC7421 zone)

EMBL: AP009493.PE396

AP009493.PE396       Location/Qualifiers
FT   CDS             428773..429084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_396"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17225"
FT                   /db_xref="GOA:B1VQC4"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQC4"
FT                   /protein_id="BAG17225.1"
FT                   /translation="MRPEHCVTRNHIEVWRGRVLPSGAERIRFGTVLRGSLLPILVWAG
FT                   VACLASFVYDPLVAAVLGGLFALSLIVGFALRRRAKHSVRCSVYGALGGVLDKSMAGF"
     MRPEHCVTRN HIEVWRGRVL PSGAERIRFG TVLRGSLLPI LVWAGVACLA SFVYDPLVAA        60
     VLGGLFALSL IVGFALRRRA KHSVRCSVYG ALGGVLDKSM AGF                         103
//

If you have problems or comments...

PBIL Back to PBIL home page