(data stored in ACNUC7421 zone)

EMBL: AP009493.PE4

AP009493.PE4         Location/Qualifiers
FT   CDS             complement(4441..5283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_4t"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_4t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16833"
FT                   /db_xref="GOA:B1VKK2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKK2"
FT                   /protein_id="BAG16833.1"
FT                   /translation="MSTDFQSARGALGARLNELRTEAGLNGRDFAQLLGWQPSKVSRLQ
FT                   NGRQTATPEDLRAWAAACGRSDTAADLLGRLRVLESRQRHWRKQLAAGHASVQDRYVVE
FT                   YRQTTVLRGYEATVIPGLFQTPDYARHLLMAHADMIQTPRDTEAAVASRMRRQEVLYAT
FT                   GKLFRVLVWEGALHALVCPRDVMAGQLDRLVGLIGMSTVEFGIVPLGAPMRLTPKHGFW
FT                   IFDESRVVVETINTELSFDTADDLDLYGRTWDGLNESAAYGARAHRIIARARHLIAPS"
     MSTDFQSARG ALGARLNELR TEAGLNGRDF AQLLGWQPSK VSRLQNGRQT ATPEDLRAWA        60
     AACGRSDTAA DLLGRLRVLE SRQRHWRKQL AAGHASVQDR YVVEYRQTTV LRGYEATVIP       120
     GLFQTPDYAR HLLMAHADMI QTPRDTEAAV ASRMRRQEVL YATGKLFRVL VWEGALHALV       180
     CPRDVMAGQL DRLVGLIGMS TVEFGIVPLG APMRLTPKHG FWIFDESRVV VETINTELSF       240
     DTADDLDLYG RTWDGLNESA AYGARAHRII ARARHLIAPS                             280
//

If you have problems or comments...

PBIL Back to PBIL home page