(data stored in ACNUC7421 zone)

EMBL: AP009493.PE40

AP009493.PE40        Location/Qualifiers
FT   CDS             complement(42264..42374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_40t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_40t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16869"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLW8"
FT                   /protein_id="BAG16869.1"
FT                   /translation="MLRIVTPSQQVRRLFGISGVDSVLEIRQTIEETVAP"
     MLRIVTPSQQ VRRLFGISGV DSVLEIRQTI EETVAP                                  36
//

If you have problems or comments...

PBIL Back to PBIL home page