(data stored in ACNUC7421 zone)

EMBL: AP009493.PE405

AP009493.PE405       Location/Qualifiers
FT   CDS             440693..441343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_405"
FT                   /product="conserved hypothetical protein containing a
FT                   fasciclin domain"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_405"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17234"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQD3"
FT                   /protein_id="BAG17234.1"
FT                   /translation="MTAFRYRRAALALTAATVLPLALSACGGGGSSDTADKAASSAPAE
FT                   EKSSAPAEGAVPADGPFGPACASVPKDGAGSFDGMAQDPVATAASNNPDLSTLVTAVKK
FT                   AGLVDTLNNAQNITVFAPTNDAFAKIPKADLDKVLADKEMLTSILTYHVVGEKLSPTQL
FT                   ESGTYDTLQKSPLTTQGSGENYTVNDTSKVVCGNVPTANATVHIVDTVLMPKA"
     MTAFRYRRAA LALTAATVLP LALSACGGGG SSDTADKAAS SAPAEEKSSA PAEGAVPADG        60
     PFGPACASVP KDGAGSFDGM AQDPVATAAS NNPDLSTLVT AVKKAGLVDT LNNAQNITVF       120
     APTNDAFAKI PKADLDKVLA DKEMLTSILT YHVVGEKLSP TQLESGTYDT LQKSPLTTQG       180
     SGENYTVNDT SKVVCGNVPT ANATVHIVDT VLMPKA                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page