(data stored in ACNUC7421 zone)

EMBL: AP009493.PE406

AP009493.PE406       Location/Qualifiers
FT   CDS             441700..442164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_406"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17235"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQD4"
FT                   /protein_id="BAG17235.1"
FT                   /translation="MAAADHRSAVHANSDDPAEQLAWRRLTARHGDRLNEIMEEYGWPT
FT                   ADLVGEEAARAAWLVAQHADRQLDVQRRALQLMRQAVSEGSAGPRELAFLHDRTLVNEG
FT                   GKQIYGTQIAGVKDGAPVPWPCEDPERVDELRADVGIEPFDAYVAQFSVA"
     MAAADHRSAV HANSDDPAEQ LAWRRLTARH GDRLNEIMEE YGWPTADLVG EEAARAAWLV        60
     AQHADRQLDV QRRALQLMRQ AVSEGSAGPR ELAFLHDRTL VNEGGKQIYG TQIAGVKDGA       120
     PVPWPCEDPE RVDELRADVG IEPFDAYVAQ FSVA                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page