(data stored in ACNUC7421 zone)

EMBL: AP009493.PE407

AP009493.PE407       Location/Qualifiers
FT   CDS             complement(442499..443608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_407"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17236"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQD5"
FT                   /protein_id="BAG17236.1"
FT                   /translation="MHVRTSAPSRRPGQAVLLVLGLLAALLAAAVPVAGPAHAAVPDRW
FT                   GFSYLDNATPPPGYVPDPSRQYGSWASPSTNPVKVDQIGLGSYVVHFPLIGGPGGIAHA
FT                   TAVSSSARWCQIADWKPVGSGQDVYVTCYLPSGAPANSTFTVLYTSSSGLPTTPTGSYG
FT                   YVNADSSGAILAQYNSTGAANAVSKGSTGLWKAWLPGLGQATHAGNLQATAVDPKQGAR
FT                   CKVSDWAPGTAGQTVVVACYNASDVPYDTEWTLSYSYQRAVHGPAFPPRSFGYLWYNGS
FT                   LPALTNYNSSGATNTLGGSGAPFVVSLPSIAVPSDTAQVTAYGKSPEYCGLHTPWDRAG
FT                   GTVRLYVACFGPGGAPVKTPFFAAYTSAR"
     MHVRTSAPSR RPGQAVLLVL GLLAALLAAA VPVAGPAHAA VPDRWGFSYL DNATPPPGYV        60
     PDPSRQYGSW ASPSTNPVKV DQIGLGSYVV HFPLIGGPGG IAHATAVSSS ARWCQIADWK       120
     PVGSGQDVYV TCYLPSGAPA NSTFTVLYTS SSGLPTTPTG SYGYVNADSS GAILAQYNST       180
     GAANAVSKGS TGLWKAWLPG LGQATHAGNL QATAVDPKQG ARCKVSDWAP GTAGQTVVVA       240
     CYNASDVPYD TEWTLSYSYQ RAVHGPAFPP RSFGYLWYNG SLPALTNYNS SGATNTLGGS       300
     GAPFVVSLPS IAVPSDTAQV TAYGKSPEYC GLHTPWDRAG GTVRLYVACF GPGGAPVKTP       360
     FFAAYTSAR                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page