(data stored in ACNUC7421 zone)

EMBL: AP009493.PE409

AP009493.PE409       Location/Qualifiers
FT   CDS             444410..444664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_409"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17238"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQD7"
FT                   /protein_id="BAG17238.1"
FT                   /translation="MVDRIRVTGAWPTDLAAALPCREEEALLGALRQPDYPALASCPIC
FT                   DEPPESVVSCVEDPTADGCSVVLVDFKPCRHGIRVPTDA"
     MVDRIRVTGA WPTDLAAALP CREEEALLGA LRQPDYPALA SCPICDEPPE SVVSCVEDPT        60
     ADGCSVVLVD FKPCRHGIRV PTDA                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page