(data stored in ACNUC7421 zone)

EMBL: AP009493.PE411

AP009493.PE411       Location/Qualifiers
FT   CDS             446330..447004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_411"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_411"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17240"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQD9"
FT                   /protein_id="BAG17240.1"
FT                   /translation="MTRDGDASMPGESLPSGNHAGPGSPPELRASHADRDRVVEVLRVA
FT                   AGDGRLTADELDERLDGALSARTLGELTALTDDLPSTADSLGAAVAEVKDVLRIEQKHS
FT                   PVTRSGRWVVPRRLVLDVKWCAVTLDFTRAVITQDTLRIDVDMRGKTLTLITGPGMVVD
FT                   ADALRLDYSRVRIRTAPDHGEPISLRIELVGEKKHGRVVVRPARRTLGQWLRGPASPGG
FT                   RG"
     MTRDGDASMP GESLPSGNHA GPGSPPELRA SHADRDRVVE VLRVAAGDGR LTADELDERL        60
     DGALSARTLG ELTALTDDLP STADSLGAAV AEVKDVLRIE QKHSPVTRSG RWVVPRRLVL       120
     DVKWCAVTLD FTRAVITQDT LRIDVDMRGK TLTLITGPGM VVDADALRLD YSRVRIRTAP       180
     DHGEPISLRI ELVGEKKHGR VVVRPARRTL GQWLRGPASP GGRG                        224
//

If you have problems or comments...

PBIL Back to PBIL home page