(data stored in ACNUC7421 zone)

EMBL: AP009493.PE424

AP009493.PE424       Location/Qualifiers
FT   CDS             459219..459659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_424"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17253"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQF2"
FT                   /protein_id="BAG17253.1"
FT                   /translation="MSLLHDVAERDGWLCWVCDEPVDPDRSVNDEQGPSVDSRTADRKA
FT                   KVAERLAHRGCNSRKGAVKVSIAWPDRLYVVEPAPLIAVASRLERKGGRETVGRCPTRQ
FT                   DAQEAADWLVDRFSRLVPGLPVTAGVESGGGQFLVVLTAGRR"
     MSLLHDVAER DGWLCWVCDE PVDPDRSVND EQGPSVDSRT ADRKAKVAER LAHRGCNSRK        60
     GAVKVSIAWP DRLYVVEPAP LIAVASRLER KGGRETVGRC PTRQDAQEAA DWLVDRFSRL       120
     VPGLPVTAGV ESGGGQFLVV LTAGRR                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page