(data stored in ACNUC7421 zone)

EMBL: AP009493.PE425

AP009493.PE425       Location/Qualifiers
FT   CDS             complement(459750..460730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_425"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_425"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17254"
FT                   /db_xref="GOA:B1VQF3"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQF3"
FT                   /protein_id="BAG17254.1"
FT                   /translation="MPSPSGPVAAMERHQVAVYVGALAAGGLAGWAAPGLGPGLEHAIN
FT                   PVLAALLYVTFLQVPAAELARSVRSGRFLAATLVVNFVVVPLVVAAMFAFLPDDRAVRL
FT                   GVLLVLLAPCIDYVIVFSGLAGGSSERLLAATPLLLLAQMALLPVYLFLFMGPDLAEVV
FT                   DAGPFVEAFLVLIVIPLALAWLTQAWAARRRAGQRVADAMGTAMVPLMAAVLLTVVASQ
FT                   VPKLGDAGSLEDVGRVVPFYVVFLVVMAFAGFAVARLFRLDAPAGRAIVFTGATRNSLV
FT                   VLPLALALPDALAVAAVVVVAQTLVEVIGMVVYVRAVPRLLPLRS"
     MPSPSGPVAA MERHQVAVYV GALAAGGLAG WAAPGLGPGL EHAINPVLAA LLYVTFLQVP        60
     AAELARSVRS GRFLAATLVV NFVVVPLVVA AMFAFLPDDR AVRLGVLLVL LAPCIDYVIV       120
     FSGLAGGSSE RLLAATPLLL LAQMALLPVY LFLFMGPDLA EVVDAGPFVE AFLVLIVIPL       180
     ALAWLTQAWA ARRRAGQRVA DAMGTAMVPL MAAVLLTVVA SQVPKLGDAG SLEDVGRVVP       240
     FYVVFLVVMA FAGFAVARLF RLDAPAGRAI VFTGATRNSL VVLPLALALP DALAVAAVVV       300
     VAQTLVEVIG MVVYVRAVPR LLPLRS                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page