(data stored in ACNUC7421 zone)

EMBL: AP009493.PE426

AP009493.PE426       Location/Qualifiers
FT   CDS             460854..461435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_426"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_426"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17255"
FT                   /db_xref="GOA:B1VQF4"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQF4"
FT                   /protein_id="BAG17255.1"
FT                   /translation="MTATYTFDVFSSLDGFGSYNGEGDWGGYWGKQGPELLDRRLSLYG
FT                   EEQRMVFGAHTYRAFVRLLAPATQESGVGDAWVTRMRSLPATVVSTTLEDPLDWPDATV
FT                   AHGDAVDVVARLKEASDVPLRSHGSLSMNRALMAAGLVDRVQVTVFPVITGRTGTEPVL
FT                   RGAADFDLELIESRTLDGRTQELTYRPTPH"
     MTATYTFDVF SSLDGFGSYN GEGDWGGYWG KQGPELLDRR LSLYGEEQRM VFGAHTYRAF        60
     VRLLAPATQE SGVGDAWVTR MRSLPATVVS TTLEDPLDWP DATVAHGDAV DVVARLKEAS       120
     DVPLRSHGSL SMNRALMAAG LVDRVQVTVF PVITGRTGTE PVLRGAADFD LELIESRTLD       180
     GRTQELTYRP TPH                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page