(data stored in ACNUC7421 zone)

EMBL: AP009493.PE427

AP009493.PE427       Location/Qualifiers
FT   CDS             complement(461464..462078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_427"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17256"
FT                   /db_xref="GOA:B1VQF5"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQF5"
FT                   /protein_id="BAG17256.1"
FT                   /translation="MKSFADPVRNYLSAVERESSALPADRRQELLADLAEHIEVTRTER
FT                   PEATIGEILAELGDPRTIAATALAEAGTETPGTRAGGGGDGPARRGKVHPLVPLLMLTL
FT                   SLPFTMIFNMGPDATFNPGPVFGFLFRVTGAVLLCTSVHWTAVQKTTGVLLTVVVPTTV
FT                   IASWNVISGWAAGETQALLGNLGVLALMVGTAVWLWRTRRA"
     MKSFADPVRN YLSAVERESS ALPADRRQEL LADLAEHIEV TRTERPEATI GEILAELGDP        60
     RTIAATALAE AGTETPGTRA GGGGDGPARR GKVHPLVPLL MLTLSLPFTM IFNMGPDATF       120
     NPGPVFGFLF RVTGAVLLCT SVHWTAVQKT TGVLLTVVVP TTVIASWNVI SGWAAGETQA       180
     LLGNLGVLAL MVGTAVWLWR TRRA                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page