(data stored in ACNUC7421 zone)

EMBL: AP009493.PE432

AP009493.PE432       Location/Qualifiers
FT   CDS             465791..467014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_432"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17261"
FT                   /db_xref="GOA:B1VQG0"
FT                   /db_xref="InterPro:IPR007815"
FT                   /db_xref="InterPro:IPR014622"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQG0"
FT                   /protein_id="BAG17261.1"
FT                   /translation="MANDIKDIAHAVDAAGVMRLFASPPRVLALGEPTHGVDAPLLLRN
FT                   ALFRQLVEREGYRTIAIESDSVAGLLVDSYVTTGSGTLDEAMGRGFSHGFGASAANREL
FT                   VDWMRAFNEGRPSGDRVRFAGFDGPLEMAYAASPREALTSLHRFLGDHVDPDLLPCTAG
FT                   TLDRLLGADDRWTDTAAMLDPSASFGRSAEAGRLRLLADDLGALLDAWTPHLIAVASRD
FT                   AFDRALMYARAASGLLRYHYWMADTSPSRLARLTGLRDQMMAGNLLALAERGPVLAHAH
FT                   NGHLQRDISSLLMGGRRLEWWSAGAVAEARLGEGYGFLATAFGTLRHQGVGVPPPETLE
FT                   GALYALPEESCLVDAAELAAVLGAPGPVPRTSPYFGYAPLDPAHLARVDGVVFMKDVPE
FT                   DRRTPPTP"
     MANDIKDIAH AVDAAGVMRL FASPPRVLAL GEPTHGVDAP LLLRNALFRQ LVEREGYRTI        60
     AIESDSVAGL LVDSYVTTGS GTLDEAMGRG FSHGFGASAA NRELVDWMRA FNEGRPSGDR       120
     VRFAGFDGPL EMAYAASPRE ALTSLHRFLG DHVDPDLLPC TAGTLDRLLG ADDRWTDTAA       180
     MLDPSASFGR SAEAGRLRLL ADDLGALLDA WTPHLIAVAS RDAFDRALMY ARAASGLLRY       240
     HYWMADTSPS RLARLTGLRD QMMAGNLLAL AERGPVLAHA HNGHLQRDIS SLLMGGRRLE       300
     WWSAGAVAEA RLGEGYGFLA TAFGTLRHQG VGVPPPETLE GALYALPEES CLVDAAELAA       360
     VLGAPGPVPR TSPYFGYAPL DPAHLARVDG VVFMKDVPED RRTPPTP                     407
//

If you have problems or comments...

PBIL Back to PBIL home page