(data stored in ACNUC7421 zone)

EMBL: AP009493.PE433

AP009493.PE433       Location/Qualifiers
FT   CDS             467142..468041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_433"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_433"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17262"
FT                   /db_xref="GOA:B1VQG1"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019922"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQG1"
FT                   /protein_id="BAG17262.1"
FT                   /translation="MTSEISGTGRTFGRVGVWSGALHTSRVDDAGGKAIAEALAELEEL
FT                   GYGTVWIGGSPTPEDAAAVVAATRSVTVATGILSIWNHTAEETAAAVAAIDPAARGRFV
FT                   LGLGVSHGPMVPQYAKPYSAMVSYLDALDAAEPSVGPGHRVLAALGSRMLKLAAGRSLG
FT                   AHPYLVTTEHTAEAREALGPDALLAPELTVVLDTDLDRARATARTMLGMYLRLPNYTDN
FT                   LLRLGFTEGDFDGGGSARLLDALFALGDAGQVRSRTREYLDAGADHVALQVLTADEGGS
FT                   GLPRAAWRELAEAFGDEL"
     MTSEISGTGR TFGRVGVWSG ALHTSRVDDA GGKAIAEALA ELEELGYGTV WIGGSPTPED        60
     AAAVVAATRS VTVATGILSI WNHTAEETAA AVAAIDPAAR GRFVLGLGVS HGPMVPQYAK       120
     PYSAMVSYLD ALDAAEPSVG PGHRVLAALG SRMLKLAAGR SLGAHPYLVT TEHTAEAREA       180
     LGPDALLAPE LTVVLDTDLD RARATARTML GMYLRLPNYT DNLLRLGFTE GDFDGGGSAR       240
     LLDALFALGD AGQVRSRTRE YLDAGADHVA LQVLTADEGG SGLPRAAWRE LAEAFGDEL        299
//

If you have problems or comments...

PBIL Back to PBIL home page