(data stored in ACNUC7421 zone)

EMBL: AP009493.PE434

AP009493.PE434       Location/Qualifiers
FT   CDS             468173..469261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_434"
FT                   /product="hypothetical protein containing a Rieske [2Fe-2S]
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_434"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17263"
FT                   /db_xref="GOA:B1VQG2"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQG2"
FT                   /protein_id="BAG17263.1"
FT                   /translation="MVREYGRTISEGPTPADAAGAPALPYPSGWSALAFSHELRPGTVL
FT                   TRPLAGRDVVLYRTATGVLRAVRPYCPHLGAHLGLAKVEGEDLTCPFHFFSFGPDGSCV
FT                   RTGYGTPPPRSPLTQLPVQEANGGVFVWRHHDGRDPDWSVPRWHEIGHRPARTAAWELA
FT                   GNVQEVIENSVDLGHFATLHGWAKAEIDGPVAYDDAKFHVAMRAHESAPLMGDFTVDVK
FT                   VDGYGLGCLHADVHTPRFGLRMCTMVMPTAIGPNRMQFRQLNRISFDEPGRLPPGLARL
FT                   VSRTAARLLDRPVFRSSCEFTAADFPIWHHKQYQQPPRLASGDGPIGPFRRWAKRFYPE
FT                   APGRTAVTRPHRGEGEDSAVLS"
     MVREYGRTIS EGPTPADAAG APALPYPSGW SALAFSHELR PGTVLTRPLA GRDVVLYRTA        60
     TGVLRAVRPY CPHLGAHLGL AKVEGEDLTC PFHFFSFGPD GSCVRTGYGT PPPRSPLTQL       120
     PVQEANGGVF VWRHHDGRDP DWSVPRWHEI GHRPARTAAW ELAGNVQEVI ENSVDLGHFA       180
     TLHGWAKAEI DGPVAYDDAK FHVAMRAHES APLMGDFTVD VKVDGYGLGC LHADVHTPRF       240
     GLRMCTMVMP TAIGPNRMQF RQLNRISFDE PGRLPPGLAR LVSRTAARLL DRPVFRSSCE       300
     FTAADFPIWH HKQYQQPPRL ASGDGPIGPF RRWAKRFYPE APGRTAVTRP HRGEGEDSAV       360
     LS                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page