(data stored in ACNUC7421 zone)

EMBL: AP009493.PE436

AP009493.PE436       Location/Qualifiers
FT   CDS             470545..471912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_436"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_436"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17265"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQG4"
FT                   /protein_id="BAG17265.1"
FT                   /translation="MPHPGRRSRPRVRGRACAVTAALALLATGCAGAGGTSFGGGDALN
FT                   VLMVNNPQMVELQKLTAKHFTKETGVKVHFTVLPENDVRDKISQDFSNQAGQYDVATIS
FT                   NFELPFFAKNGWLHPLDDYAKADTAFDQEDILAPLRESLTAEDGKLYAQPFYGESSFLM
FT                   YRKDVFEERGLTMPDRPTWQQVAKLAERADGAERGMKGICLRGLPGWGEVIAPLTTVVN
FT                   TMGGTWFTEDWEPRLTAPEFKKATKFYVDLVREHGELGAPQSGYAECLNNMTQGKTAMW
FT                   YDATAGAGSLEAKGSPVKGKIGYVPAPVERTDSSGWLYTWAWGLQKASKKADDAWKFVS
FT                   WASGKEYEELVGATSGWSNVPAGKRASTYANPDYRAEAGAFADVTERAISEADPRNPGV
FT                   QPRPTAGIQFVGVPEFTDLGTRVAQEISAAIAGRQSVDAALDASQKLAEKVAEEYR"
     MPHPGRRSRP RVRGRACAVT AALALLATGC AGAGGTSFGG GDALNVLMVN NPQMVELQKL        60
     TAKHFTKETG VKVHFTVLPE NDVRDKISQD FSNQAGQYDV ATISNFELPF FAKNGWLHPL       120
     DDYAKADTAF DQEDILAPLR ESLTAEDGKL YAQPFYGESS FLMYRKDVFE ERGLTMPDRP       180
     TWQQVAKLAE RADGAERGMK GICLRGLPGW GEVIAPLTTV VNTMGGTWFT EDWEPRLTAP       240
     EFKKATKFYV DLVREHGELG APQSGYAECL NNMTQGKTAM WYDATAGAGS LEAKGSPVKG       300
     KIGYVPAPVE RTDSSGWLYT WAWGLQKASK KADDAWKFVS WASGKEYEEL VGATSGWSNV       360
     PAGKRASTYA NPDYRAEAGA FADVTERAIS EADPRNPGVQ PRPTAGIQFV GVPEFTDLGT       420
     RVAQEISAAI AGRQSVDAAL DASQKLAEKV AEEYR                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page