(data stored in ACNUC7421 zone)

EMBL: AP009493.PE437

AP009493.PE437       Location/Qualifiers
FT   CDS             471909..472868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_437"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_437"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17266"
FT                   /db_xref="GOA:B1VQG5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQG5"
FT                   /protein_id="BAG17266.1"
FT                   /translation="MTVTATRETTAPTAPAEKSGGGRRRAWATRAPLLPALIFLIAVTQ
FT                   LPFVATLVISFFDWNSLKPEKRHFTGFSNYASVFTDEALRESVVTTVVLTASVVIVSVV
FT                   LGLVFALLLDRAFFGRGFVRTLLITPFLLVPVSAALLWKHALYNPEYGLFNGALTWFGE
FT                   LFGIESVAQPEWTSEMPLIAIEASLVWQWTPFMMLILLAGLQSRPAEIMEAARLDGAGP
FT                   WQIFRHLTLPHLRRYLELGILLGSVYIVQNFDAVFTITSGGLGTANLPYTVYETFYRAH
FT                   EYGLASAAGVVVVIGTIVIATFALRTVSSLFREEASRA"
     MTVTATRETT APTAPAEKSG GGRRRAWATR APLLPALIFL IAVTQLPFVA TLVISFFDWN        60
     SLKPEKRHFT GFSNYASVFT DEALRESVVT TVVLTASVVI VSVVLGLVFA LLLDRAFFGR       120
     GFVRTLLITP FLLVPVSAAL LWKHALYNPE YGLFNGALTW FGELFGIESV AQPEWTSEMP       180
     LIAIEASLVW QWTPFMMLIL LAGLQSRPAE IMEAARLDGA GPWQIFRHLT LPHLRRYLEL       240
     GILLGSVYIV QNFDAVFTIT SGGLGTANLP YTVYETFYRA HEYGLASAAG VVVVIGTIVI       300
     ATFALRTVSS LFREEASRA                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page